PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010539392.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family HRT-like
Protein Properties Length: 489aa    MW: 54703.2 Da    PI: 9.0672
Description HRT-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010539392.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HRT-like56.54.6e-18283313131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGvil+dG+ C+++PvkgRKRC eHKG Ri
  XP_010539392.1 283 VCGVILKDGTSCTKTPVKGRKRCTEHKGERI 313
                     7****************************97 PP

2HRT-like56.64.4e-18342372131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGvil dG +C++ Pv gRKRCe HKGmRi
  XP_010539392.1 342 TCGVILVDGETCSNRPVSGRKRCESHKGMRI 372
                     7*****************************7 PP

3HRT-like32.41.6e-10410436228
        HRT-like   2 CGviledGsvCkrqPvkgRKRCeeHKG 28 
                     C +i++ Gs+C+r+P kg  RC++HK 
  XP_010539392.1 410 CEAITKSGSPCTRSPSKGSRRCWQHKE 436
                     99************************7 PP

4HRT-like60.62.4e-19457487131
        HRT-like   1 iCGviledGsvCkrqPvkgRKRCeeHKGmRi 31 
                     +CGv+l dGsvC+ +PvkgRKRCe HKGmRi
  XP_010539392.1 457 TCGVKLYDGSVCEGSPVKGRKRCELHKGMRI 487
                     7*****************************7 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000033Biological Processregulation of seed dormancy process
GO:0097100Molecular Functionsupercoiled DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MEFGDGFPFA VVDAMFKRED YKQTKHDPIF TKWQVLIGSN DWEDFRNGKD GATRYRVQNL  60
PCKSCPGLYE LGVGIIGHDQ ARQVDSHDVL VAYLGQAESV RSRLQCYGRS GAHLKNVNLT  120
CDNNGCELDE SLDRKAVTAG LFEDIFSKGG SILYRWAPMK SKREAEVKEV LLLGTFDYAW  180
NKGSNGERRH QDLLEKLGHH KFMSKRTERF PWMHVFSFAK DHVGVKIKGE KHILAEEREL  240
KGDTEKEKKS SNLLSGILKL SRNRPQPVSD TSDNVVGADS GPVCGVILKD GTSCTKTPVK  300
GRKRCTEHKG ERICRVSPKP SPEKHKMCEV SPGKNHQESD ITCGVILVDG ETCSNRPVSG  360
RKRCESHKGM RINAFLFLLN HAEREKNILD QKSSPGKCSE LNQKSDSLFC EAITKSGSPC  420
TRSPSKGSRR CWQHKERMSK DETSPENISP AGVNQVTCGV KLYDGSVCEG SPVKGRKRCE  480
LHKGMRITS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010539392.10.0PREDICTED: uncharacterized protein LOC104813490
SwissprotF4K9330.0ET2_ARATH; Protein EFFECTOR OF TRANSCRIPTION 2
TrEMBLD7MM690.0D7MM69_ARALL; Putative uncharacterized protein
STRINGAT5G56780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM29542763
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56780.10.0effector of transcription2